Overview

  • Product name
    Recombinant Human 68kDa Neurofilament/NF-L protein (His tag)
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSL SVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRF ASFIERVHELEQQNKVLEAELLVLRQKHSEPSRFRALYEQEIRDLRLAAE DATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEARKGADE AALARAELEKRIDSLMDEISFLKKVHEEEIAELQAQIQYAQISVEMDVTK PDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRAA KDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTI NKLENELRTTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLS FTSVGSITSGYSQSSQVFGRSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQ IEVEETIEAAKAEEAKDEPPSEGEAEEEEKDKEEAEEEEAAEEEEAAKEE SEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD
    • Molecular weight
      81 kDa including tags
    • Amino acids
      2 to 543
    • Tags
      His tag N-Terminus
    • Additional sequence information
      10xHis-SUMO tag at the N-terminus and Myc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab224840 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    LC-MS/MS
  • Purity
    > 90 % SDS-PAGE.

  • Form
    Liquid
  • Additional notes

    Previously labelled as 68kDa Neurofilament. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names
    • 68 kDa neurofilament protein
    • 68kDa Neurofilament
    • 68kDa neurofilament protein
    • CMT1F
    • CMT2E
    • FLJ53642
    • Light molecular weight neurofilament protein
    • NEFL
    • Neurofilament light
    • Neurofilament light polypeptide
    • Neurofilament light polypeptide 68kDa
    • Neurofilament protein, light chain
    • Neurofilament subunit NF L
    • Neurofilament triplet L protein
    • NF-L
    • NF68
    • NFL
    • NFL_HUMAN
    see all
  • Function
    Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber.
  • Involvement in disease
    Defects in NEFL are the cause of Charcot-Marie-Tooth disease type 1F (CMT1F) [MIM:607734]. CMT1F is a form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT1 group are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet. CMT1F is characterized by onset in infancy or childhood (range 1 to 13 years).
    Defects in NEFL are the cause of Charcot-Marie-Tooth disease type 2E (CMT2E) [MIM:607684]. CMT2E is an autosomal dominant form of Charcot-Marie-Tooth disease type 2. Neuropathies of the CMT2 group are characterized by signs of axonal regeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy.
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Domain
    The extra mass and high charge density that distinguish the neurofilament proteins from all other intermediate filament proteins are due to the tailpiece extensions. This region may form a charged scaffolding structure suitable for interaction with other neuronal components or ions.
  • Post-translational
    modifications
    O-glycosylated.
    Phosphorylated in the Head and Rod regions by the PKC kinase PKN1, leading to inhibit polymerization.
  • Information by UniProt

Images

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab224840 could indicate that this peptide derived from E.coli-expressed human Neurofilament protein.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab224840 could indicate that this peptide derived from E.coli-expressed human Neurofilament protein.

References

ab224840 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224840.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up