For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-68kda-neurofilamentnf-l-protein-his-tag-ab224840.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Cell Adhesion Proteins Cytoskeletal Proteins Intermediate Filaments
Share by email

Recombinant Human 68kDa Neurofilament/NF-L protein (His tag) (ab224840)

  • Datasheet
  • SDS
Reviews (1) Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Mass Spectrometry - Recombinant Human 68kDa Neurofilament/NF-L protein (His tag) (ab224840)
  • Mass Spectrometry - Recombinant Human 68kDa Neurofilament/NF-L protein (His tag) (ab224840)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 90% SDS-PAGE
  • Tags: His tag N-Terminus
  • Suitable for: MS, SDS-PAGE

You may also be interested in

Primary
Product image
Anti-Human IgA antibody [RM128] (ab193189)
Peptide
Product image
Human beta Tubulin peptide (ab20775)

View more associated products

Description

  • Product name

    Recombinant Human 68kDa Neurofilament/NF-L protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

    P07196
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSL SVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRF ASFIERVHELEQQNKVLEAELLVLRQKHSEPSRFRALYEQEIRDLRLAAE DATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEARKGADE AALARAELEKRIDSLMDEISFLKKVHEEEIAELQAQIQYAQISVEMDVTK PDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRAA KDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTI NKLENELRTTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLS FTSVGSITSGYSQSSQVFGRSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQ IEVEETIEAAKAEEAKDEPPSEGEAEEEEKDKEEAEEEEAAEEEEAAKEE SEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD
    • Predicted molecular weight

      81 kDa including tags
    • Amino acids

      2 to 543
    • Tags

      His tag N-Terminus
    • Additional sequence information

      10xHis-SUMO tag at the N-terminus and Myc tag at the C-terminus.

Associated products

  • Related Products

    • Anti-68kDa Neurofilament/NF-L antibody (ab113854)
    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-68kDa Neurofilament/NF-L antibody [EP675Y] (ab52989)
    • Anti-68kDa Neurofilament/NF-L antibody [2F11], prediluted (ab74592)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab224840 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Additional notes

    Previously labelled as 68kDa Neurofilament. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.2
    Constituents: 50% Glycerol (glycerin, glycerine), Tris buffer

General Info

  • Alternative names

    • 68 kDa neurofilament protein
    • 68kDa Neurofilament
    • 68kDa neurofilament protein
    • CMT1F
    • CMT2E
    • FLJ53642
    • Light molecular weight neurofilament protein
    • NEFL
    • Neurofilament light
    • Neurofilament light polypeptide
    • Neurofilament light polypeptide 68kDa
    • Neurofilament protein, light chain
    • Neurofilament subunit NF L
    • Neurofilament triplet L protein
    • NF-L
    • NF68
    • NFL
    • NFL_HUMAN
    see all
  • Function

    Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber.
  • Involvement in disease

    Defects in NEFL are the cause of Charcot-Marie-Tooth disease type 1F (CMT1F) [MIM:607734]. CMT1F is a form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT1 group are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet. CMT1F is characterized by onset in infancy or childhood (range 1 to 13 years).
    Defects in NEFL are the cause of Charcot-Marie-Tooth disease type 2E (CMT2E) [MIM:607684]. CMT2E is an autosomal dominant form of Charcot-Marie-Tooth disease type 2. Neuropathies of the CMT2 group are characterized by signs of axonal regeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Domain

    The extra mass and high charge density that distinguish the neurofilament proteins from all other intermediate filament proteins are due to the tailpiece extensions. This region may form a charged scaffolding structure suitable for interaction with other neuronal components or ions.
  • Post-translational
    modifications

    O-glycosylated.
    Phosphorylated in the Head and Rod regions by the PKC kinase PKN1, leading to inhibit polymerization.
  • Target information above from: UniProt accession P07196 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Mass Spectrometry - Recombinant Human 68kDa Neurofilament/NF-L protein (His tag) (ab224840)
    Mass Spectrometry - Recombinant Human 68kDa Neurofilament/NF-L protein (His tag) (ab224840)

    Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab224840 could indicate that this peptide derived from E.coli-expressed human Neurofilament protein.

  • Mass Spectrometry - Recombinant Human 68kDa Neurofilament/NF-L protein (His tag) (ab224840)
    Mass Spectrometry - Recombinant Human 68kDa Neurofilament/NF-L protein (His tag) (ab224840)

    Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab224840 could indicate that this peptide derived from E.coli-expressed human Neurofilament protein.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (1)

Publishing research using ab224840? Please let us know so that we can cite the reference in this datasheet.

ab224840 has been referenced in 1 publication.

  • Liu HC  et al. Development of an assay of plasma neurofilament light chain utilizing immunomagnetic reduction technology. PLoS One 15:e0234519 (2020). PubMed: 32530970

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

Recombinant Human 68kDa Neurofilament/NF-L protein (His tag) (ab224840) with Human NEFL Antibody Pair - BSA and Azide Free (ab253512)

Excellent
Abreviews
Abreviews
abreview image
Application
Sandwich ELISA
Recombinant Human 68kDa Neurofilament/NF-L protein (His tag) (ab224840) was used with Human NEFL Antibody Pair - BSA and Azide Free (ab253512) in a sandwich ELISA assay following the ‘How to use Matched Antibody Pair Kit ‘ provided by Abcam. In short, Recombinant Human 68kDa Neurofilament/NF-L protein (His tag) (ab224840) diluted to 2ng/mL in blocking buffer. Two-fold serial dilutions to a minimum concentration of 2pg/mL were used to form the standard curve. The plate was read immediately after the addition of Stop Solution at 450nm absorbance. Measurements were taken in duplicate and blocking buffer (1x) was used as a blank control. Average optical density was calculated and plotted against the concentration of Recombinant Human 68kDa Neurofilament/NF-L protein (His tag) (ab224840). The limit of detection of this assay was ~23pg/mL.
The protein arrived in solution and was easy to use in sandwich ELISA. It arrived at an appropriate concentration in a compatible storage buffer, and we are pleased that it worked with the antibody pair kit. It shows a limit of detection comparable to other sandwich ELISAs available on the market and we are pleased with the results.
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted May 17 2021

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.