Overview

  • Product name

    Recombinant Human AADAC/DAC protein (Tagged)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPP TSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALS GYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVL AKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQ PLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVE SSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLL ADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFH GAFSFLGLKISHRLINQYIEWLKENL
    • Molecular weight

      63 kDa including tags
    • Amino acids

      24 to 399
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Lumenal domain. N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.

Specifications

Our Abpromise guarantee covers the use of ab235022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as AADAC

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • AAAD_HUMAN
    • Aada
    • Aadac
    • Arylacetamide deacetylase
    • Arylacetamide deacetylase (esterase)
    • CES5A1
    • DAC
    see all
  • Function

    Arylacetamide deacetylation is an important enzyme activity in the metabolic activation of arylamine substrates to ultimate carcinogens. Displays major serine hydrolase activity in liver microsomes. Hydrolyzes also flutamide, which is an antiandrogen drug used for the treatment of prostate cancer that occasionaly causes severe hepatotoxicity. Displays cellular triglyceride lipase activity in liver. Increases intracellular fatty acids derived from hydrolysis of newly formed triglyceride stores.
  • Tissue specificity

    Mainly expressed in liver, small intestine, colon and adrenal gland.
  • Sequence similarities

    Belongs to the 'GDXG' lipolytic enzyme family.
  • Cellular localization

    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Images

  • ab235022 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235022 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AADAC/DAC.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235022 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AADAC/DAC.

References

ab235022 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235022.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up