Overview

  • Product name

    Recombinant Human AAK1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MKKFFDSRREQGGSGLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDE VLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGH KNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTGFTENE VLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATN KFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGC LLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDK RPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPK ARLTDPIPTTETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPPP QAAGSSNQPGLLASVPQPKPQAPPSQPLPQTQAKQPQAPPTPQQTPSTQA QGLPAQAQATPQHQQHTIKLSMKL
    • Amino acids

      1 to 474
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AAK 1
    • Aak1
    • AAK1_HUMAN
    • Adaptor associated kinase 1
    • Adaptor-associated kinase 1
    • AP2 associated kinase 1
    • AP2 associated protein kinase 1
    • AP2-associated protein kinase 1
    • DKFZp686F03202
    • DKFZp686K16132
    • FLJ23712
    • FLJ25931
    • FLJ31060
    • FLJ42882
    • FLJ45252
    • KIAA1048
    • MGC138170
    • MGC164568
    • MGC164570
    see all
  • Function

    Phosphorylates the AP2M1/mu2 subunit of the adaptor protein complex 2 (AP-2). May play a role in regulating aspects of clathrin-mediated endocytosis.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Membrane. Cell membrane. Membrane > clathrin-coated pit. Active when found in clathrin-coated pits at the plasma membrane.
  • Information by UniProt

Images

  • ab153192 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153192 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up