Overview

  • Product name

    Recombinant Human ABCB5 protein (Tagged)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEY QGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQL KEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPD LGTDDDDKAMAIRSADLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQD IKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLP EVSLLKILKL NKPEWPFV
    • Molecular weight

      29 kDa including tags
    • Amino acids

      141 to 247
    • Additional sequence information

      Trx tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab185403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab185403 is greater than 95% pure as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS. Please aliquot the reconstituted solution. After reconstitution aliquot and store at < -20 degrees, avoid freeze/thaw cycles.

General Info

  • Alternative names

    • ABCB 5
    • ABCB5
    • ABCB5 P-gp
    • ABCB5_HUMAN
    • ABCB5alpha
    • ABCB5beta
    • ATP binding cassette protein
    • ATP binding cassette sub family B (MDR/TAP) member 5
    • ATP binding cassette sub family B member 5
    • ATP-binding cassette sub-family B member 5
    • EST422562
    • P glycoprotein ABCB5
    • P-glycoprotein ABCB5
    see all
  • Function

    Plasma membrane transporter able to mediate efflux from cells of the rhodamine dye and of the therapeutic drug doxorubicin. Responsible for the resistance to doxorubicin of a subset of malignant melanomas.
  • Tissue specificity

    Expressed by CD133-expressing progenitor cells among epidermal melanocytes (at protein level). Widely expressed with specific expression in pigment cells. Also expressed in several malignant tissues.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.
    Contains 1 ABC transmembrane type-1 domain.
    Contains 2 ABC transporter domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab185403 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185403.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up