Overview

  • Product name

    Recombinant Human ABCC10 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MLVSVERLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLP NALDGVTFCVQPGEKLGIVGRTGSGKSSLLLVLFRLLEPSSGRVLLDGVD TSQLELAQLRSQLAIIPQEPFLFSGTVRENLDPQGLHKDRALWQALKQCH LSEVITSMGGLDGELGEGGRSLSLGQRQLLCLARALLTDAKILCIDEATA SVDQKTDQLLQQTICKRFANKTVLTIAHRLNTILNSDRVLVLQAGRVVEL DSPATLRNQPHSLFQQLLQSSQQGVPASLGGP
    • Amino acids

      1 to 282
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153564 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ABCC10
    • ATP binding cassette, sub family C (CFTR/MRP), member 10
    • ATP binding cassette, subfamily C, member 10
    • ATP-binding cassette sub-family C member 10
    • EST182763
    • mFLJ00002
    • MRP7
    • MRP7_HUMAN
    • Multidrug resistance associated protein 7
    • Multidrug resistance-associated protein 7
    • SIMRP7
    see all
  • Function

    ATP-dependent transporter probably involved in cellular detoxification through lipophilic anion extrusion.
  • Tissue specificity

    Isoform 1 is specifically expressed in spleen. Isoform 2 is more widely expressed.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab153564 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153564 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153564.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up