Recombinant Human ABCC11 protein (ab164741)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEATLS WQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINL
    • Amino acids
      433 to 532
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABCC 11
    • ATP binding cassette protein C11
    • ATP binding cassette sub family C (CFTR/MRP) member 11
    • ATP binding cassette sub family C member 11
    • ATP binding cassette transporter MRP8
    • ATP binding cassette transporter sub family C member 11
    • EWWD
    • MRP8
    • Multi resistance protein 8
    • Multidrug resistance associated protein 8
    • OTTHUMP00000164191
    • WW
    see all
  • Relevance
    ABCC11 belongs to the ABC transporter family, conjugate transporter (TC 3.A.1.208) subfamily. It contains two ABC transmembrane type-1 domains and two ABC transporter domains. ABCC11 participates in physiological processes involving bile acids, conjugated steroids and cyclic nucleotides and enhances the cellular extrusion of cAMP and cGMP. It also stimulates the ATP-dependent uptake of a range of physiological and synthetic lipophilic anions, including the glutathione S-conjugates leukotriene C4 and dinitrophenyl S-glutathione, steroid sulfates such as dehydroepiandrosterone 3-sulfate (DHEAS) and estrone 3-sulfate, glucuronides such as estradiol 17-beta-D-glucuronide (E(2)17betaG), the monoanionic bile acids glycocholate and taurocholate, and methotrexate. It probably functions to secrete earwax.
  • Cellular localization
    Membrane; Multi-pass membrane protein.

Images

  • ab164741 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164741 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up