Description

  • Product name

    Recombinant Human ABCG4 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAEKALEAVGCGLGPGAVAMAVTLEDGAEPPVLTTHLKKVENHITEAQRF SHLPKRSAVDIEFVELSYSVREGPCWRKRGYKTLLKCLSGKFCRRELIGI MGPSGAGKSTFMNILAGYRESGMKGQILVNGRPRELRTFRKMSCYIMQDD MLLPHLTVLEAMMVSANLKLSEKQEVKKELVTEILTALGLMSCSHTRTAL LSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKSLAQGG RTIICTIHQPSAKLFEMFDKLYILSQGQCIFKGVVTNLIPYLKGLGLHCP TYHNPADFIIEVASGEYGDLNPMLFRAVQNGLCAMAEKKSSPEKNEVPAP CPPCPPEVDPIESHTFATSTLTQFCILFKRTFLSILRDTVLTHLRFMSHV VIGVLIGLLYLHIGDDASKVFNNTGCLFFSMLFLMFAALMPTVLTFPLEM AVFMREHLNYWYSLKAYYLAKTMADVPFQVVCPVVYCSIVYWMTGQPAET SRFLLFSALATATALVAQSLGLLIGAASNSLQVATFVGPVTAIPVLLFSG FFVSFKTIPTYLQWSSYLSYVRYGFEGVILTIYGVERGDLTCLEERCPFR EPQSILRALDVEDAKLYMDFLVLGIFFLALRLLAYLVLRYRVKSER
    • Amino acids

      1 to 646
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ABCG 4
    • ATP binding cassette subfamily G member 4
    • ATP-binding cassette, sub-family G (WHITE), member 4
    • Putative ABC transporter
    • WHITE 2
    • WHITE2
    see all
  • Relevance

    The ATP binding cassette (ABC) superfamily of membrane transporters is one of the largest protein classes known, and counts for numerous proteins involved in trafficking of biological molecules across membranes. ABCG4 protein is highly expressed in both human and mouse brain, it is a 646aa molecule in human (chr 11q23) and mouse. It is an integral membrane protein may be involved in macrophage lipid homeostasis. The ABCG4 protein’s abundant expression in brain and close evolutionary relationship to the other members of the subfamily suggests a potential role in cholesterol transport.
  • Cellular localization

    Membrane; Multi-pass membrane protein

Images

  • ab163789 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

The elution buffer we used to purify the protein is 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0. This is also the storage buffer.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up