Recombinant Human ABHD14A protein (ab161817)

Description

  • Product name

    Recombinant Human ABHD14A protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVGALCGCWFRLGGARPLIPLGPTVVQTSMSQSQVALLGLSLLLMLLLYV GLPGPPEQTSCLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLL HGKAFNSHTWEQLGTLQLLSQRGYRAVALDLPGFGNSAPSKEASTEAGRA ALLERALRDLEVQNAVLVSPSLSGHYALPFLMRGHHQLHGFVPIAPTSTQ NYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHA CYLHKPQDFHLVLLAFLDHLP
    • Amino acids

      1 to 271
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ60317
    • ABHD14A
    • ABHEA_HUMAN
    • Abhydrolase domain containing 14A
    • Abhydrolase domain containing protein 14A
    • Abhydrolase domain-containing protein 14A
    • Alpha/beta hydrolase domain-containing protein 14A
    • DORZ1
    • FLJ60467
    see all
  • Function

    Possible role in granule neuron development.
  • Sequence similarities

    Belongs to the AB hydrolase superfamily. ABHD14 family.
  • Cellular localization

    Cytoplasm. Membrane.
  • Information by UniProt

Images

  • ab161817 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161817 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161817.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up