Recombinant Human ABHD6 protein (ab132683)

Description

  • Product name

    Recombinant Human ABHD6 protein
    See all ABHD6 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQV RYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHL VCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMG GQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKI PLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEI VSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
    • Predicted molecular weight

      65 kDa
    • Amino acids

      1 to 337

Specifications

Our Abpromise guarantee covers the use of ab132683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 0610041D24Rik
    • 2 arachidonoylglycerol hydrolase
    • AA673485
    • Abhydrolase domain containing 6
    • Abhydrolase domain containing protein 6
    • AV065425
    • Llipase protein
    • MGC94917
    see all
  • Relevance

    ABHD6 belongs to the alpha/beta hydrolase superfamily. It is highly expressed in mammalian brain and catalyzes the hydrolysis of the endocannabinoid 2-arachidonoyl glycerol (2-AG).
  • Cellular localization

    Membrane; Single-pass type II membrane protein

Images

  • 12.5% SDS-PAGE analysis of ab132683 stained with Coomassie Blue.

References

ab132683 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up