Overview

  • Product name

    Recombinant Human Abi-1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      GTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTH SGSS
    • Amino acids

      185 to 238
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160761 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Abelson interactor 1
    • Abi-1
    • Abi1
    • ABI1_HUMAN
    • Abl binding protein 4
    • Abl interactor 1
    • Abl interactor protein 1
    • Abl-binding protein 4
    • AblBP4
    • e3B1
    • Eps8 binding protein
    • Eps8 SH3 domain binding protein
    • Eps8 SH3 domain-binding protein
    • Eps8-binding protein
    • Hssh3bp1
    • Interactor protein AblBP4
    • NAP1
    • Nap1 binding protein
    • Nap1-binding protein
    • Nap1BP
    • Spectrin SH3 domain binding protein 1
    • Spectrin SH3 domain-binding protein 1
    • SSH3BP
    see all
  • Function

    May act in negative regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. May play a role in regulation of EGF-induced Erk pathway activation. Involved in cytoskeletal reorganization and EGFR signaling. Together with EPS8 participates in transduction of signals from Ras to Rac. In vitro, a trimeric complex of ABI1, EPS8 and SOS1 exhibits Rac specific guanine nucleotide exchange factor (GEF) activity and ABI1 seems to act as an adapter in the complex. Regulates ABL1/c-Abl-mediated phosphorylation of ENAH. Recruits WASF1 to lamellipodia and there seems to regulate WASF1 protein level.
  • Tissue specificity

    Widely expressed, with highest expression in brain.
  • Involvement in disease

    Note=A chromosomal aberration involving ABI1 is a cause of acute leukemias. Translocation t(10;11)(p11.2;q23) with MLL. ABI1 isoform 2 was found to be present in acute leukemia MLL-ABI1 fusion transcript.
  • Sequence similarities

    Belongs to the ABI family.
    Contains 1 SH3 domain.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Domain

    The t-SNARE coiled-coil homology domain is necessary and sufficient for interaction with STX1A.
  • Post-translational
    modifications

    In vitro substrate for v-Abl (By similarity). Phosphorylated on tyrosine residues after serum stimulation or induction by v-Abl.
  • Cellular localization

    Cytoplasm. Nucleus. Cell projection > lamellipodium. Cell projection > filopodium. Cell projection > growth cone. Cell junction > synapse > synaptosome. Cytoplasm > cytoskeleton. Localized to protruding lamellipodia and filopodia tips. Also localized to neuronal growth cones and synaptosomes.
  • Information by UniProt

Images

  • ab160761 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160761 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160761.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up