Overview

  • Product name

    Recombinant Human ABI3 protein (denatured)
  • Protein length

    Full length protein
  • Description

    Recombinant Human ABI3 protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAELQQLQEFEIPTGREALRGNHSALL RVADYCEDNYVQATDKRKALEETMAFTTQALASVAYQVGNLAGHTLRMLD LQGAALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQRLPPGQKVIAP ENLPPLTPYCRRPLNFGCLDDIGHGIKDLSTQLSRTGTLSRKSIKAPATP ASATLGRPPRIPEPVHLPVVPDGRLSAASSASSLASAGSAEGVGGAPTPK GQAAPPAPPLPSSLDPPPPPAAVEVFQRPPTLEELSPPPPDEELPLPLDL PPPPPLDGDELGLPPPPPGFGPDEPSWVPASYLEKVVTLYPYTSQKDNEL SFSEGTVICVTRRYSDGWCEGVSSEGTGFFPGNYVEPSC
    • Molecular weight

      41 kDa including tags
    • Amino acids

      1 to 366
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134548 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • ABI family member 3
    • ABI gene family member 3
    • Nesh
    • New molecule including SH3
    • SSH3BP3
    see all
  • Relevance

    ABI3 is thought to inhibit tumor metastasis. In vitro, ABI3 reduces cell motility.
  • Cellular localization

    Cytoplasmic

Images

  • 15% SDS-PAGE analysis of 3µg ab134548.

References

ab134548 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134548.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up