Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPN LVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECNRQEVNAVVLLYMATQI SSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHA GAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQ VYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMF QESSISDEVEKELGKQGVRGAVSTLLQAPELPTK
    • Molecular weight

      33 kDa including tags
    • Amino acids

      248 to 531
    • Modifications

      mutated T315 I
    • Tags

      His tag N-Terminus
    • Additional sequence information

      GenBank Accession No. NM_005157. Note: This mutation is often cited as T344I in variant B (GenBank Accession No. NM_007313).

Specifications

Our Abpromise guarantee covers the use of ab196134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 222 pmoles/min/μg.
    Assay Conditions: Activity was determined using a 100% phosphorylated Tyr02 peptide and a Z-lyte kinase assay. Reaction was incubated at 30°C for 1 hour.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    > 75 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    Previously labelled as c Abl.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.4% Tris HCl, 0.58% Sodium chloride, 0.05% Tween, 20% Glycerol, 0.05% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Abelson murine leukemia viral oncogene homolog 1
    • Abelson tyrosine protein kinase 1
    • ABL
    • Abl 1
    • ABL proto oncogene 1 non receptor tyrosine kinase
    • ABL1
    • ABL1_HUMAN
    • bcr/abl
    • bcr/c abl oncogene protein
    • c ABL
    • c abl oncogene 1 non receptor tyrosine kinase
    • c abl oncogene 1 receptor tyrosine kinase
    • c ABL1
    • JTK7
    • p150
    • Proto oncogene tyrosine protein kinase ABL1
    • Proto-oncogene c-Abl
    • Tyrosine-protein kinase ABL1
    • v abl
    • v abl Abelson murine leukemia viral oncogene homolog 1
    see all
  • Function

    Protein kinase that regulates key processes linked to cell growth and survival. Regulates cytoskeleton remodeling during cell differentiation, cell division and cell adhesion. Localizes to dynamic actin structures, and phosphorylates CRK and CRKL, DOK1, and other proteins controlling cytoskeleton dynamics. Regulates DNA repair potentially by activating the proapoptotic pathway when the DNA damage is too severe to be repaired. Phosphorylates PSMA7 that leads to an inhibition of proteasomal activity and cell cycle transition blocks.
  • Tissue specificity

    Widely expressed.
  • Involvement in disease

    Note=A chromosomal aberration involving ABL1 is a cause of chronic myeloid leukemia. Translocation t(9;22)(q34;q11) with BCR. The translocation produces a BCR-ABL found also in acute myeloid leukemia (AML) and acute lymphoblastic leukemia (ALL).
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. ABL subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications

    Phosphorylated by PRKDC (By similarity). DNA damage-induced activation of c-Abl requires the function of ATM and Ser-446 phosphorylation (By similarity). Phosphorylation on Thr-735 is required for binding 14-3-3 proteins for cytoplasmic translocation.
    Isoform IB is myristoylated on Gly-2.
  • Cellular localization

    Cytoplasm > cytoskeleton. Nucleus. Sequestered into the cytoplasm through interaction with 14-3-3 proteins and Nucleus membrane. The myristoylated c-ABL protein is reported to be nuclear.
  • Information by UniProt

Images

  • Specific activity of ab196134 was determined to be 222 pmol/min/μg

  • 10% SDS-PAGE analysis of ab196134 stained with Coomassie Blue.
    Lane 1: ab196134 (4µg)
    Lane 2: Protein Marker

References

ab196134 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up