Description

  • Product name

    Recombinant human ABL1 protein
    See all ABL1 proteins and peptides
  • Biological activity

    Specific Activity: 2,700 pmoles/min/μg.

     

    Assay was performed in Kinase buffer containing 0.2 mM DTT using Abltide substrate (0.2 mg/mL) and 20 mM ATP. Reaction was done at 30°C for 30 min. Amount of ATP transferred was calculated.

  • Purity

    >= 65 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTM EVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLR ECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVK VADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVL LWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQW NPSDRPSFAEIHQAFETMFQESSISDEVEKELGK
    • Predicted molecular weight

      33 kDa
    • Amino acids

      248 to 531
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NM_007313.

Specifications

Our Abpromise guarantee covers the use of ab196111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    Previously labelled as c Abl.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 1.36% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 0.0462% DTT, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Abelson murine leukemia viral oncogene homolog 1
    • Abelson tyrosine protein kinase 1
    • ABL
    • Abl 1
    • ABL proto oncogene 1 non receptor tyrosine kinase
    • ABL1
    • ABL1_HUMAN
    • bcr/abl
    • bcr/c abl oncogene protein
    • c ABL
    • c abl oncogene 1 non receptor tyrosine kinase
    • c abl oncogene 1 receptor tyrosine kinase
    • c ABL1
    • JTK7
    • p150
    • Proto oncogene tyrosine protein kinase ABL1
    • Proto-oncogene c-Abl
    • Tyrosine-protein kinase ABL1
    • v abl
    • v abl Abelson murine leukemia viral oncogene homolog 1
    see all
  • Function

    Protein kinase that regulates key processes linked to cell growth and survival. Regulates cytoskeleton remodeling during cell differentiation, cell division and cell adhesion. Localizes to dynamic actin structures, and phosphorylates CRK and CRKL, DOK1, and other proteins controlling cytoskeleton dynamics. Regulates DNA repair potentially by activating the proapoptotic pathway when the DNA damage is too severe to be repaired. Phosphorylates PSMA7 that leads to an inhibition of proteasomal activity and cell cycle transition blocks.
  • Tissue specificity

    Widely expressed.
  • Involvement in disease

    Note=A chromosomal aberration involving ABL1 is a cause of chronic myeloid leukemia. Translocation t(9;22)(q34;q11) with BCR. The translocation produces a BCR-ABL found also in acute myeloid leukemia (AML) and acute lymphoblastic leukemia (ALL).
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. ABL subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications

    Phosphorylated by PRKDC (By similarity). DNA damage-induced activation of c-Abl requires the function of ATM and Ser-446 phosphorylation (By similarity). Phosphorylation on Thr-735 is required for binding 14-3-3 proteins for cytoplasmic translocation.
    Isoform IB is myristoylated on Gly-2.
  • Cellular localization

    Cytoplasm > cytoskeleton. Nucleus. Sequestered into the cytoplasm through interaction with 14-3-3 proteins and Nucleus membrane. The myristoylated c-ABL protein is reported to be nuclear.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 2.5 µg ab196111 with Coomassie staining.

  • Kinase assay using ab196111 showing the specific activity as 2,700 pmoles/min/µg.

References

ab196111 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up