Overview

  • Product name

    Recombinant Human ABP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPALGWAVAATLMLQTAMAEPSPGTLPRKAGVFSDLSNQELKAVHSFLWS KKELRLQPSSTTTMAKNTVFLIEMLLPKKYHVLRFLDKGERHPVREARAV IFFGDQEHPNVTEFAVGPLPGPCYMRALSPRPGYQSSWASRPISTAEYAL LYHTLQEATKPPHQFFLNTTGFSFQDCHDRCLAFTDVAPRGVASGQRRSW LIIQRYVEGYFLHPTGLELLVDHGSTDAGHWAVEQVWYNGKFYGSPEELA RKYADGEVDVVVLEDPLPGGKGHDSTEEPPLFSSHKPRGDFPSPIHVSGP RLVQPHGPRFRLEGNAVLYGGWSFAFRLRSSSGLQVLNVHFGGERIAYEV SVQEAVALYGGHTPAGMQTKYLDVGWGLGSVTHELAPGIDCPETATFLDT FHYYDADDPVHYPRALCLFEMPTGVPLRRHFNSNFKGGFNFYAGLKGQVL VLRTTSTVYNYDYIWDFIFYPNGVMEAKMHATGYVHATFYTPEGLRHGTR LHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQMKLENITNPWSPRHRVV QPTLEQTQYSWERQAAFRFKRKLPKYLLFTSPQENPWGHKRSYRLQIHSM ADQVLPPGWQEEQAITWARYPLAVTKYRESELCSSSIYHQNDPWDPPVVF EQFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFN FFPEDPSLASRDTVIVWPRDNGPNYVQRWIPEDRDCSMPPPFSYNGTYRP V
    • Molecular weight

      108 kDa including tags
    • Amino acids

      1 to 751

Specifications

Our Abpromise guarantee covers the use of ab132902 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ABP
    • Abp1
    • ABP1_HUMAN
    • Amiloride binding protein
    • Amiloride binding protein 1
    • Amiloride binding protein 1 (amine oxidase (copper containing))
    • Amiloride sensitive amine oxidase
    • Amiloride-binding protein
    • Amiloride-sensitive amine oxidase [copper-containing]
    • Amine oxidase copper domain containing protein 1
    • AOC1
    • DAO
    • DAO1
    • Diamine oxidase
    • Histaminase
    • KAO
    • Kidney amine oxidase
    see all
  • Function

    Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function.
  • Tissue specificity

    Placenta and kidney.
  • Sequence similarities

    Belongs to the copper/topaquinone oxidase family.
  • Post-translational
    modifications

    Topaquinone (TPQ) is generated by copper-dependent autoxidation of a specific tyrosyl residue.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt

Images

  • ab132902 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab132902 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132902.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up