Overview

  • Product name

    Recombinant Human AC5 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      ADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGN TVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMT YFLNGGPPLS
    • Amino acids

      1152 to 1261
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as ADCY5. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AC 5
    • AC5
    • ADCY 5
    • Adcy5
    • ADCY5_HUMAN
    • Adenylate cyclase type 5
    • Adenylate cyclase type V
    • Adenylyl cyclase 5
    • ATP pyrophosphate lyase 5
    • ATP pyrophosphate-lyase 5
    see all
  • Function

    This is a membrane-bound, calcium-inhibitable adenylyl cyclase.
  • Sequence similarities

    Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
    Contains 2 guanylate cyclase domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab157850 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157850 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up