Overview

  • Product name

    Recombinant Human ACAA2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSFGAYGGLLKDFTATDLSEFAAKAALSA GKVSPETVDSVIMGNVLQSSSDAIYLARHVGLRVGIPKETPALTINRLCG SGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGSDIK LEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECDKYALQSQQRWKAA NDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDG TVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSIMG IGPVPAISGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNV NGGAIALGHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIAVII QSTA
    • Molecular weight

      43 kDa including tags
    • Amino acids

      17 to 397
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab140734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 85 % SDS-PAGE.
    ab140734 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • 3 ketoacyl CoA thiolase
    • 3 ketoacyl CoA thiolase mitochondrial
    • 3-ketoacyl-CoA thiolase, mitochondrial
    • 3-oxoacyl-CoA thiolase, mitochondrial
    • ACAA 2
    • Acaa2
    • Acetyl CoA acyltransferase
    • Acetyl CoA acyltransferase 2
    • Acetyl Coenzyme A acyltransferase 2
    • Acetyl-CoA acyltransferase
    • Beta ketothiolase
    • Beta-ketothiolase
    • DSAEC
    • Mitochondrial 3 oxoacyl CoA thiolase
    • Mitochondrial 3 oxoacyl Coenzyme A thiolase
    • Mitochondrial 3-oxoacyl-CoA thiolase
    • T1
    • THIM_HUMAN
    see all
  • Function

    Abolishes BNIP3-mediated apoptosis and mitochondrial damage.
  • Pathway

    Lipid metabolism; fatty acid metabolism.
  • Sequence similarities

    Belongs to the thiolase family.
  • Cellular localization

    Mitochondrion. Colocalizes with BNIP3 in the mitochondria.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab140734 (3 µg).

References

ab140734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up