Overview

  • Product name

    Recombinant Human ACAD9 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSGCGLFLRTTAAARACRGLVVSTANRRLLRTSPPVRAFAKELFLGKIKK KEVFPFPEVSQDELNEINQFLGPVEKFFTEEVDSRKIDQEGKIPDETLEK LKSLGLFGLQVPEEYGGLGFSNTMYSRLGEIISMDGSITVTLAAHQAIGL KGIILAGTEEQKAKYLPKLASGEHIAAFCLTEPASGSDAASIRSRATLSE DKKHYILNGSKVWITNGGLANIFTVFAKTEVVDSDGSVKDKITAFIVERD FGGVTNGKPEDKLGIRGSNTCEVHFENTKIPVENILGEVGDGFKVAMNIL NSGRFSMGSVVAGLLKRLIEMTAEYACTRKQFNKRLSEFGLIQEKFALMA QKAYVMESMTYLTAGMLDQPGFPDCSIEAAMVKVFSSEAAWQCVSEALQI LGGLGYTRDYPYERILRDTRILLIFEGTNEILRMYIALTGLQHAGRILTT RIHELKQAKVSTVMDTVGRRLRDSLGRTVDLGLTGNHGVVHPSLADSANK FEENTYCFGRTVETLLLRFGKTIMEEQLVLKRVANILINLYGMTAVLSRA SRSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKK VSQQILEKRAYICAHPLDRTC
    • Molecular weight

      95 kDa including tags
    • Amino acids

      1 to 621

Specifications

Our Abpromise guarantee covers the use of ab132991 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Acyl CoA dehydrogenase 9
    • Acyl Coenzyme A dehydrogenase family, member 9
    • acyl-CoA dehydrogenase family member 9, mitochondrial
    • FLJ23533
    • MGC14452
    • NPD002
    • Very long chain acyl CoA dehydrogenase VLCAD
    see all
  • Relevance

    ACAD9 belongs to a group of Acyl CoA dehydrogenases (ACADs). This family of proteins localize to the mitochondria and catalyze the rate-limiting step in the beta-oxidation of fatty acyl-CoA. One of the main energy producing metabolic pathways in eukaryotes is mitochondrial fatty acid beta oxidation. ACADs act on fatty acids containing 14 to 20 carbons. ACAD9 is specifically active toward palmitoyl-CoA and long-chain unsaturated substrates. Mutations in this gene cause acyl-CoA dehydrogenase family member type 9 deficiency. Alternate splicing results in multiple transcript variants.
  • Cellular localization

    Mitochondrial

Images

  • 12.5% SDS-PAGE analysis of ab132991 stained with Coomassie Blue.

References

ab132991 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132991.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up