Description

  • Product name

    Recombinant Human ACADM/MCAD protein
    See all ACADM/MCAD proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab173059 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPV PLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEG NSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTK AEKKGDEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVE ADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMG AFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAE MAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQI LGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYKN
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      26 to 421
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Sequence for the tag: MGSSHHHHHHSSGLVPRGSHM

Specifications

Our Abpromise guarantee covers the use of ab173059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Additional notes

    Previously labelled as ACADM. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.50
    Constituents: 0.24% Tris, 0.58% Sodium chloride, 20% Glycerol

    ab173059 is supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names

    • ACAD 1
    • ACAD1
    • Acadm
    • ACADM_HUMAN
    • Acyl coenzyme A dehydrogenase
    • Acyl coenzyme A dehydrogenase C 4 to C 12 straight chain
    • FLJ18227
    • FLJ93013
    • FLJ99884
    • MCAD
    • MCADH
    • Medium chain acyl CoA dehydrogenase
    • Medium chain fatty acyl CoA dehydrogenase
    • Medium chain specific acyl CoA dehydrogenase
    • Medium chain specific acyl CoA dehydrogenase mitochondrial
    • Medium-chain specific acyl-CoA dehydrogenase
    • mitochondrial
    see all
  • Function

    This enzyme is specific for acyl chain lengths of 4 to 16.
  • Pathway

    Lipid metabolism; mitochondrial fatty acid beta-oxidation.
  • Involvement in disease

    Defects in ACADM are the cause of acyl-CoA dehydrogenase medium-chain deficiency (ACADMD) [MIM:201450]. It is an autosomal recessive disease which causes fasting hypoglycemia, hepatic dysfunction, and encephalopathy, often resulting in death in infancy.
  • Sequence similarities

    Belongs to the acyl-CoA dehydrogenase family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt

References

ab173059 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173059.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up