Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMKANRQREPGLGFSFEFTEQQKEFQATARK FAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFD ACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPL MCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLL ARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFED VKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYAL ERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYA SIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTS QIQRLIVAREHIDKYKN
    • Molecular weight

      46 kDa including tags
    • Amino acids

      26 to 421
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab99329 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

    Previously labelled as ACADM. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • ACAD 1
    • ACAD1
    • Acadm
    • ACADM_HUMAN
    • Acyl coenzyme A dehydrogenase
    • Acyl coenzyme A dehydrogenase C 4 to C 12 straight chain
    • FLJ18227
    • FLJ93013
    • FLJ99884
    • MCAD
    • MCADH
    • Medium chain acyl CoA dehydrogenase
    • Medium chain fatty acyl CoA dehydrogenase
    • Medium chain specific acyl CoA dehydrogenase
    • Medium chain specific acyl CoA dehydrogenase mitochondrial
    • Medium-chain specific acyl-CoA dehydrogenase
    • mitochondrial
    see all
  • Function

    This enzyme is specific for acyl chain lengths of 4 to 16.
  • Pathway

    Lipid metabolism; mitochondrial fatty acid beta-oxidation.
  • Involvement in disease

    Defects in ACADM are the cause of acyl-CoA dehydrogenase medium-chain deficiency (ACADMD) [MIM:201450]. It is an autosomal recessive disease which causes fasting hypoglycemia, hepatic dysfunction, and encephalopathy, often resulting in death in infancy.
  • Sequence similarities

    Belongs to the acyl-CoA dehydrogenase family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab99329.

References

ab99329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up