Overview

  • Product name

    Recombinant Human ACAP2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGK AFCVANKQFMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQ TQRSIKAQLQNFVKEDLRKFKDAKKQFEKVSEEKENALVKNAQVQRNKQH EVEEATNILTATRKCFRHIALDYVLQINVLQSKRRSEILKSMLSFMYAHL AFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKREMEQKHSTIQQKDF SSDDSKLEYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQK KFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQ AWIKAVQTSIATAYREKGDESEKLDKKSSPSTGSLDSGNESKEKLLKGES ALQRVQCIPGNASCCDCGLADPRWASINLGITLCIECSGIHRSLGVHFSK VRSLTLDTWEPELLKLMCELGNDVINRVYEANVEKMGIKKPQPGQRQEKE AYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGDQV RASAQSSVRSNDSEIQQSSDDGRESLPSTVSANSLYEPEGERQDSSMFLD SKHLNPGLQLYRASYEKNLPKMAEALAHGADVNWANSEENKATPLIQAVL GGSLVTCEFLLQNGANVNQRDVQGRGPLHHATVLGHTGQVCLFLKRGANQ HATDEEGKDPLSIAVEAANADIVTLLRLARMNEEMRESEGLYGQPGDETY QDIFRDFSQMASNNPEKLNRFQQDSQKF
    • Molecular weight

      115 kDa including tags
    • Amino acids

      1 to 778

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as Centaurin beta 2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ACAP 2
    • ACAP2
    • ACAP2_HUMAN
    • ANK repeat and PH domain-containing protein 2
    • Arf GAP with coiled coil ANK repeat and PH domain containing protein 2
    • Arf GAP with coiled coil ANK repeat and PH domains 2
    • Arf-GAP with coiled-coil
    • ArfGAP with coiled coil ankyrin repeat and PH domains 2
    • CENT B 2
    • Centaurin beta2
    • Centaurin-beta-2
    • CENTB 2
    • CENTB2
    • Cnt b2
    • Cnt-b2
    • Cntb2
    • KIAA0041
    • Similar to yeast ZINC FINGER PROTEIN GCS1
    see all
  • Function

    GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6).
  • Tissue specificity

    Widely expressed. Highest level in lung.
  • Sequence similarities

    Contains 3 ANK repeats.
    Contains 1 Arf-GAP domain.
    Contains 1 BAR domain.
    Contains 1 PH domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132322 stained with Coomassie Blue.

References

ab132322 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up