Description

  • Product name

    Recombinant Human ACAT2/Acetyl-CoA acetyltransferase protein
    See all ACAT2/Acetyl-CoA acetyltransferase proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEY QGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQL KEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPD LGTDDDDKAMADIGSMNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGS TVIKEVLKRATVAPEDVSEVIFGHVLAAGCGQNPVRQASVGAGIPYSVPA WSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGMENMSKAPHLAYLRTGV KIGEMPLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLS QNRTENAQKAGHFDKEIVPVLVSTRRGLIEVKTDEFPRHGSNIEAMSKLK PYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARIVSWSQ VGVEPSIMGIGPIPAIKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKEL GLNPEKVNIEGGAIALGHPLGASGCRILVTLLHTLERMGRSRGVAALCIG GGMGIAMCVQRE
    • Predicted molecular weight

      59 kDa including tags
    • Amino acids

      1 to 397
    • Tags

      His-DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185836 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as ACAT2, Acetyl-CoA acetyltransferase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names

    • Acat2
    • acetoacetyl CoA thiolase
    • acetoacetyl Coenzyme A thiolase
    • Acetyl CoA acetyltransferase
    • Acetyl CoA transferase like protein
    • acetyl Coenzyme A acetyltransferase 2
    • Acetyl-CoA acetyltransferase
    • Acetyl-CoA transferase-like protein
    • Acyl Coenzyme A cholesterol acyltransferase 2
    • cytosolic
    • Cytosolic acetoacetyl-CoA thiolase
    • SOAT2
    • THIC_HUMAN
    see all
  • Sequence similarities

    Belongs to the thiolase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab185836 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185836.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up