Description

  • Product name

    Recombinant human Acetyl Coenzyme A Carboxylase protein
    See all Acetyl Coenzyme A Carboxylase proteins and peptides
  • Biological activity

    Specific Activity: ≥42.5 pmol/min/µg.

    A 25 μl Acetyl Coenzyme A carboxylase alpha reaction is conducted in a buffer containing 30 mM HEPES (pH 7.4), 2 mM MgCl2, 2 mM potassium citrate, 1 mM DTT, 100 μM ATP, 12 mM NaHCO3 and 20 μM acetyl-CoA at 30°C for 45 min. ATP reduction is detected.

  • Purity

    >= 70 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MWWSTLMSILRARSFWKWISTQTVRIIRAVRAHFGGIMDEPSPLAQPLEL NQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDLG ISSLQDGLALHIRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFG GNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLK ANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHAS ENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGS GLRVDWQENDFSKRILNVPQELYEKGYVKDVDDGLQAAEEVGYPVMIKAS EGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQIL ADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAK MVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQ IAMGIPLYRIKDIRMMYGVSPWGDSPIDFEDSAHVPCPRGHVIAARITSE NPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSW GENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQMNRIDTGWL DRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQVLPA HTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGG LLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLI QYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALDPGC VLAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNV MNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPN VEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFM NTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFAL REENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNIL TELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGH QFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYEL NSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLNHYGMTH VASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSPPQS PTFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQ QNKATLVDHGIRRLTFLVAQKDFRKQVNYEVDRRFHREFPKFFTFRARDK FEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVG TEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNN TNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAEL KINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLW ESMSTQAFLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWK MTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPR IYVSANSGARIGLAEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSA LNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNE IITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVY TSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSVPLL NSKDPIDRIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEI MQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQ AGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKF GAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSINPRHMEMYADRES RGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKE LENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRT FFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYV WDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPE VAMDSIIHMTQHISPTQRAEVIRILSTMDSPSTDYKDDDDKHHHHHH
    • Predicted molecular weight

      270 kDa including tags
    • Amino acids

      1 to 2383
    • Tags

      His-DDDDK tag C-Terminus
    • Additional sequence information

      NM_198834.

Specifications

Our Abpromise guarantee covers the use of ab196428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 2.9% Sodium chloride, 10% Glycerol, 0.02% DTT

    Contains 100 µg/ml DDDDK peptide.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ACAC
    • ACACA
    • ACACA_HUMAN
    • ACACB
    • ACC
    • ACC alpha
    • ACC beta
    • ACC-alpha
    • ACC1
    • ACC2
    • ACCA
    • ACCB
    • Acetyl CoA carboxylase 1
    • Acetyl CoA carboxylase 2
    • Acetyl CoA carboxylase alpha
    • Acetyl CoA carboxylase beta
    • Acetyl Coenzyme A carboxylase alpha
    • Acetyl Coenzyme A carboxylase beta
    • Biotin carboxylase
    • COA1
    • COA2
    • HACC275
    • OTTHUMP00000164069
    • OTTHUMP00000164070
    • OTTHUMP00000164076
    • OTTHUMP00000240532
    see all
  • Function

    Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase.
  • Tissue specificity

    Expressed in brain, placental, skeletal muscle, renal, pancreatic and adipose tissues; expressed at low level in pulmonary tissue; not detected in the liver.
  • Pathway

    Lipid metabolism; malonyl-CoA biosynthesis; malonyl-CoA from acetyl-CoA: step 1/1.
  • Involvement in disease

    Acetyl-CoA carboxylase 1 deficiency
  • Sequence similarities

    Contains 1 ATP-grasp domain.
    Contains 1 biotin carboxylation domain.
    Contains 1 biotinyl-binding domain.
    Contains 1 carboxyltransferase domain.
  • Post-translational
    modifications

    Phosphorylation on Ser-1263 is required for interaction with BRCA1.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 2 µg ab196428 with Coomassie staining.

  • Activity assay of ab196428.

References

ab196428 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196428.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up