Description

  • Product name

    Recombinant Human Acid Phosphatase 2 protein (denatured)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSRSLRFVTLLYRHGDRSPVKTYPKDPYQ EEEWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDF DRTLMSAEANLAGLFPPNGMQRFNPNISWQPIPVHTVPITEDRLLKFPLG PCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVY DTLFCEQTHGLRLPPWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQG GVLLAQIRKNLTLMATTSQLPKLLVYSAHDTTLVALQMALDVYNGEQAPY ASCHIFELYQEDSGNFSVEMYFRNESDKAPWPLSLPGCPHRCPLQDFLRL TEPVVPKDWQQECQLASGPADTE
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      31 to 380
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Lumenal domain (NP_001601).
  • Description

    Recombinant Human Acid Phosphatase 2 protein

Specifications

Our Abpromise guarantee covers the use of ab202151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 10% Glycerol, 0.32% Tris HCl

General Info

  • Alternative names

    • Acid phosphatase 2 lysosomal
    • ACP 2
    • ACP2
    • LAP
    • Lysosomal acid phosphatase
    • Lysosomal acid phosphatase 2
    • PPAL_HUMAN
    see all
  • Involvement in disease

    Defects in ACP2 are a cause of acid phosphatase deficiency (ACPHD) [MIM:200950]. The clinical features are intermittent vomiting, hypotonia, lethargy, opisthotonos, terminal bleeding, and death in early infancy. Lysosomal acid phosphatase is deficient in cultured fibroblasts and multiple tissues.
  • Sequence similarities

    Belongs to the histidine acid phosphatase family.
  • Post-translational
    modifications

    The membrane-bound form is converted to the soluble form by sequential proteolytic processing. First, the C-terminal cytoplasmic tail is removed. Cleavage by a lysosomal protease releases the soluble form in the lysosome lumen.
    N-glycosylated. The intermediates formed during enzymatic deglycosylation suggest that all eight predicted N-glycosylation sites are used.
  • Cellular localization

    Lysosome membrane. Lysosome lumen. The soluble form arises by proteolytic processing of the membrane-bound form.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202151 (3 µg).

References

ab202151 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up