Description

  • Product name

    Recombinant Human Acid sphingomyelinase protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLALALALALALALSDS RVLWAPAEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAIN LGLKKEPNVARVGSVAIKLCNLLKIAPPAVCRSIVHLFEDDMVEVWRRSV LSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSR ILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKC DLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVT ALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWE PWLPAEALRTLRCI
    • Predicted molecular weight

      66 kDa including tags
    • Amino acids

      1 to 364

Specifications

Our Abpromise guarantee covers the use of ab132844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Reduced glutathione

General Info

  • Alternative names

    • Acid sphingomyelinase
    • ASM
    • ASM_HUMAN
    • aSMase
    • NPD
    • Smpd1
    • Sphingomyelin phosphodiesterase
    • Sphingomyelin phosphodiesterase 1 acid lysosomal
    see all
  • Function

    Converts sphingomyelin to ceramide. Also has phospholipase C activities toward 1,2-diacylglycerolphosphocholine and 1,2-diacylglycerolphosphoglycerol. Isoform 2 and isoform 3 have lost catalytic activity.
  • Involvement in disease

    Defects in SMPD1 are the cause of Niemann-Pick disease type A (NPDA) [MIM:257200]; also known as Niemann-Pick disease classical infantile form. It is an early-onset lysosomal storage disorder caused by failure to hydrolyze sphingomyelin to ceramide. It results in the accumulation of sphingomyelin and other metabolically related lipids in reticuloendothelial and other cell types throughout the body, leading to cell death. Niemann-Pick disease type A is a primarily neurodegenerative disorder characterized by onset within the first year of life, mental retardation, digestive disorders, failure to thrive, major hepatosplenomegaly, and severe neurologic symptoms. The severe neurological disorders and pulmonary infections lead to an early death, often around the age of four. Clinical features are variable. A phenotypic continuum exists between type A (basic neurovisceral) and type B (purely visceral) forms of Niemann-Pick disease, and the intermediate types encompass a cluster of variants combining clinical features of both types A and B.
    Defects in SMPD1 are the cause of Niemann-Pick disease type B (NPDB) [MIM:607616]; also known as Niemann-Pick disease visceral form. It is a late-onset lysosomal storage disorder caused by failure to hydrolyze sphingomyelin to ceramide. It results in the accumulation of sphingomyelin and other metabolically related lipids in reticuloendothelial and other cell types throughout the body, leading to cell death. Clinical signs involve only visceral organs. The most constant sign is hepatosplenomegaly which can be associated with pulmonary symptoms. Patients remain free of neurologic manifestations. However, a phenotypic continuum exists between type A (basic neurovisceral) and type B (purely visceral) forms of Niemann-Pick disease, and the intermediate types encompass a cluster of variants combining clinical features of both types A and B. In Niemann-Pick disease type B, onset of the first symptoms occurs in early childhood and patients can survive into adulthood.
  • Sequence similarities

    Belongs to the acid sphingomyelinase family.
    Contains 1 saposin B-type domain.
  • Cellular localization

    Lysosome.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab132844 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Other
We tested the activity of the Recombinant Human Acid sphingomyelinase protein (ab132844) by performing a sphingomyelinase activity assay. Unfortunately the enzyme is not active.

Mittelwert Umsatz [nmol/4h] Umsatz [nmol/h]
10µl H2O 3199919 0,455628947 0,113907237
5µl Enzym 3241011 0,46147994 0,115369985
2,5µl Enzym 3262453 0,464533016 0,116133254

Abcam user community

Verified customer

Submitted Aug 01 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up