Recombinant Human ACOT11 protein (ab161875)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADGEGYRNPTEVQMSQLVLPCHTNQRGELSVGQLLKWIDTTACLSAERH AGCPCVTASMDDIYFEHTISVGQVVNIKAKVNRAFNSSMEVGIQVASEDL CSEKQWNVCK
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACO11_HUMAN
    • ACOT 11
    • ACOT11
    • Acyl CoA thioester hydrolase 11
    • Acyl CoA thioesterase 11
    • Acyl coenzyme A thioesterase 11
    • Acyl-CoA thioester hydrolase 11
    • Acyl-CoA thioesterase 11
    • Acyl-coenzyme A thioesterase 11
    • Adipose associated thioesterase
    • Adipose-associated thioesterase
    • BFIT
    • BFIT 1
    • BFIT 2
    • BFIT1
    • BFIT2
    • Brown fat inducible thioesterase
    • Brown fat-inducible thioesterase
    • KIAA0707
    • OTTHUMP00000046722
    • StAR related lipid transfer (START) domain containing 14
    • STARD 14
    • STARD14
    • START domain containing 14
    • THEA
    • THEM 1
    • THEM1
    • Thioesterase adipose associated
    • Thioesterase superfamily member 1
    see all
  • Function
    Has acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates.
  • Tissue specificity
    Isoform 1 is predominantly expressed in skeletal muscle, liver, testis, stomach, spleen, lung and brain. Isoform 2 is predominantly expressed in kidney, uterus, hibernoma and white adipose tissue.
  • Sequence similarities
    Contains 2 acyl coenzyme A hydrolase domains.
    Contains 1 START domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab161875 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161875 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up