Description

  • Product name

    Recombinant Human ACOX1/AOX protein (His tag)
    See all ACOX1/AOX proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMNPDLRRERDSASFNPELLTHILDGSPEKT RRRREIENMILNDPDFQHEDLNFLTRSQRYEVAVRKSAIMVKKMREFGIA DPDEIMWFKNFVHRGRPEPLDLHLGMFLPTLLHQATAEQQERFFMPAWNL EIIGTYAQTEMGHGTHLRGLETTATYDPETQEFILNSPTVTSIKWWPGGL GKTSNHAIVLAQLITKGKCYGLHAFIVPIREIGTHKPLPGITVGDIGPKF GYDEIDNGYLKMDNHRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVF VRSFLVGEAARALSKACTIAIRYSAVRHQSEMKPGEPEPQILDFQTQQYK LFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAF TSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQ TARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSP ESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAH CHYVVVKLFSEKLLKIQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIM TEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYE NLFEWAKNSPLNKAEVHESYKHLKSLQSKL
    • Predicted molecular weight

      77 kDa including tags
    • Amino acids

      1 to 660
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab215640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as ACOX1. 
     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: 0.24% Tris, 20% Glycerol, 2.9% Sodium chloride, 0.05% DTT

General Info

  • Alternative names

    • ACOX
    • ACOX1
    • ACOX1_HUMAN
    • Acyl CoA oxidase 1 palmitoyl
    • Acyl CoA oxidase straight chain
    • AOX
    • EC 1.3.3.6
    • PALMCOX
    • Palmitoyl CoA oxidase
    • Palmitoyl-CoA oxidase
    • Peroxisomal acyl coenzyme A oxidase 1
    • Peroxisomal acyl-coenzyme A oxidase 1
    • Peroxisomal fatty acyl CoA oxidase
    • SCOX
    • Straight chain acyl CoA oxidase
    • Straight-chain acyl-CoA oxidase
    see all
  • Function

    Catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. Isoform 1 shows highest activity against medium-chain fatty acyl-CoAs and activity decreases with increasing chain length. Isoform 2 is active against a much broader range of substrates and shows activity towards very long-chain acyl-CoAs. Isoform 2 is twice as active as isoform 1 against 16-hydroxy-palmitoyl-CoA and is 25% more active against 1,16-hexadecanodioyl-CoA.
  • Tissue specificity

    Widely expressed with highest levels of isoform 1 and isoform 2 detected in testis. Isoform 1 is expressed at higher levels than isoform 2 in liver and kidney while isoform 2 levels are higher in brain, lung, muscle, white adipose tissue and testis. Levels are almost equal in heart.
  • Pathway

    Lipid metabolism; peroxisomal fatty acid beta-oxidation.
  • Involvement in disease

    Adrenoleukodystrophy, pseudoneonatal
  • Sequence similarities

    Belongs to the acyl-CoA oxidase family.
  • Cellular localization

    Peroxisome.
  • Information by UniProt

References

ab215640 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up