Overview

  • Product name
    Recombinant Human ACSL6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQTQEILRILRLPELGDLGQFFRSLSATTLDSGGARRSVIGSGPQLLTHY YDDARTMYQVFRRGLSISGNGPCLGFRKPKQPYQWLSYQEVADRAEFLGS GLLQHNCKACTDQFIGVFAQNRPEWIIVELACYTYSMVVVPLYDTLGPGA IRYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFEEALK ERGQKCGVVIKSMQAVEDCGQANHQAPVPPQPDDLSIVCFTSGTTGNPKG AMLTHGNVVADFSGFLKVTEGDIRLLSDDMKALCPTIFPVVPRLLNRMYD KIFSQANTPLKRWLLEFAAKRKQAEVRSGIIRNDSIWDELFFNKIQASLG GCVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDW TSGHVGAPLPCNHIKLVDVEELNYWACKGEGEICVRGPNVFKGYLKDPDR TKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIEN IYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLC TNKDLKKAILEDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLK AKRPELREYFKKQIEELYSISM
    • Amino acids
      1 to 622
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACS2
    • Acyl CoA synthetase long chain family member 6
    • FACL6
    • Fatty acid Coenzyme A ligase, long chain 6
    • LACS 6
    • LACS2
    • LACS5
    • Long chain acyl CoA synthetase 6
    • Long chain fatty acid CoA ligase 6
    • Long fatty acyl CoA synthetase 2
    see all
  • Relevance
    ACSL6 belongs to the ATP-dependent AMP-binding enzyme family. It is involved in the activation of long-chain fatty acids for both synthesis of cellular lipids and degradation via beta-oxidation. ACSL6 plays an important role in fatty acid metabolism in brain and the acyl-CoAs produced may be utilized exclusively for the synthesis of the brain lipid. ACSL6 is expressed predominantly in erythrocyte precursors, in particular in reticulocytes, fetal blood cells derived from fetal liver, haemopoietic stem cells from cord blood, bone marrow, and brain. There are three named isoforms.
  • Cellular localization
    Mitochondrion outer membrane; Single-pass type III membrane protein. Peroxisome membrane; Single-pass type III membrane protein. Microsome membrane; Single-pass type III membrane protein. Endoplasmic reticulum membrane; Single-pass type III membrane protein.

Images

  • ab161598 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up