Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQV CQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFS SESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVR CCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQISWNQGIDLWWHELMQE AGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVF DFHAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDVNRLW SIVDKYKVTKFYTAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPE AWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSATFPFFG VAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHERFETTYFKKFP GYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVA EAAVVGHPHPVKGECLYCFVTLCDGHTFSPKLTEELKKQIREKIGPIATP DYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDMSTVADPSVISHLFSH RCLTIQ
    • Molecular weight

      94 kDa including tags
    • Amino acids

      96 to 701

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132411 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ACAS2
    • AceCS
    • Acetate CoA ligase
    • Acetate thiokinase
    • Acetate--CoA ligase
    • Acetyl CoA synthetase
    • Acetyl Coenzyme A synthetase 2 (ADP forming)
    • Acetyl coenzyme A synthetase cytoplasmic
    • Acetyl-CoA synthetase
    • Acetyl-coenzyme A synthetase
    • ACS
    • ACSA
    • ACSA_HUMAN
    • ACSS2
    • Acyl activating enzyme
    • Acyl CoA synthetase short chain family member 2
    • Acyl-activating enzyme
    • Acyl-CoA synthetase short-chain family member 2
    • cytoplasmic
    • Cytoplasmic acetyl coenzyme A synthetase
    • MYH7B
    see all
  • Function

    Activates acetate so that it can be used for lipid synthesis or for energy generation.
  • Sequence similarities

    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132411, stained with Coomassie Blue.

References

ab132411 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132411.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up