Bioactive grade

Recombinant human Activin A Receptor Type IB/ALK-4 protein (Fc Chimera) (ab182676)

Description

  • Product name

    Recombinant human Activin A Receptor Type IB/ALK-4 protein (Fc Chimera)
    See all Activin A Receptor Type IB/ALK-4 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.

    Immobilized Human TDGF1 at 2 μg/ml (100 μl/well) can bind ab182676 with a linear range of 0.032 - 2 μg/ml.

  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKV ELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWG PVE
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      24 to 126
    • Additional sequence information

      Fused with Fc fragment of Human IgG1 at the C-terminus. Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab182676 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    DTT-reduced Activin A Receptor Type IB / ALK-4 migrates as 43-46 kDa and non-reduced protein migrates as 85-90 kDa.

    Previously labelled as Activin A Receptor Type IB. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.6% Tris, 0.75% Glycine, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 200 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Activin A receptor type 1B
    • Activin A receptor type II like kinase 4
    • Activin A type 1B receptor
    • Activin A type IB receptor
    • Activin receptor like kinase 4
    • Activin receptor type 1B
    • Activin receptor type IB
    • Activin receptor type-1B
    • Activin receptor-like kinase 4
    • ACTR IB
    • ACTR-IB
    • ACTRIB
    • ACV1B_HUMAN
    • ACVR 1B
    • Acvr1b
    • ACVRLK 4
    • ACVRLK4
    • ALK 4
    • ALK-4
    • ALK4
    • Serine(threonine) protein kinase receptor R2
    • Serine/threonine-protein kinase receptor R2
    • SKR 2
    • SKR2
    see all
  • Function

    On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Phosphorylates TDP2.
  • Tissue specificity

    Expressed in many tissues, most strongly in kidney, pancreas, brain, lung, and liver.
  • Sequence similarities

    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
    Contains 1 GS domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Immobilized Human Activin A, Tag Free at 10µg/mL (100 µL/well) can bind Human ACVR1B, Fc Tag with a linear range of 0.3-2.5 µg/mL.
  • The purity of ab182676 was determined by DTT-reduced (+) and non-reduced (-) SDS-PAGE and staining overnight with Coomassie Blue.

References

ab182676 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182676.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up