Description

  • Product name

    Recombinant human Activin Receptor Type IA (mutated Q207 D) protein
    See all Activin Receptor Type IA proteins and peptides
  • Biological activity

    The specific activity of ab190988 was determined to be 18 nmol/ min/ mg.

  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGL PFLVQRTVAR QITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKS WFRETELYNTVMLRHENILGFI ASDMTSRHSSTQLWLITHYHEMGSLY DYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGT QGKPAIAHRDLKSK NILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEV LD ETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPND PSFEDMRK VVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARL TALRIKKTLTKIDNSLDKLKTDC
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      147 to 509
    • Tags

      proprietary tag N-Terminus
    • Additional sequence information

      Cytoplasmic domain.

Specifications

Our Abpromise guarantee covers the use of ab190988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 25% Glycerol, 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.002% PMSF, 0.004% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Activin A receptor type I
    • Activin A receptor type II like kinase 2
    • Activin receptor type I
    • Activin receptor type-1
    • Activin receptor-like kinase 2
    • ACTR-I
    • ACTRI
    • Acvr1
    • ACVR1_HUMAN
    • ACVR1A
    • ACVRLK2
    • ALK 2
    • ALK-2
    • ALK2
    • FOP
    • Hydroxyalkyl protein kinase
    • Serine/threonine-protein kinase receptor R1
    • SKR1
    • TGF-B superfamily receptor type I
    • TGFB superfamily receptor type I
    • TSR-I
    • TSRI
    see all
  • Function

    On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin. May be involved for left-right pattern formation during embryogenesis.
  • Tissue specificity

    Expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells.
  • Involvement in disease

    Defects in ACVR1 are a cause of fibrodysplasia ossificans progressiva (FOP) [MIM:135100]. FOP is a rare autosomal dominant disorder of skeletal malformations and progressive extraskeletal ossification. Heterotopic ossification in FOP begins in childhood and can be induced by trauma or may occur without warning. Bone formation is episodic and progressive, leading to extra-articular ankylosis of all major joints of the axial and appendicular skeleton, rendering movement impossible.
  • Sequence similarities

    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
    Contains 1 GS domain.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • The specific activity of ab190988 was determined to be 18 nmol/ min/ mg.

  • The purity of ab190988 was determined to be >95% by densitometry, approx MW ~67 kDa.

References

ab190988 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up