Recombinant human Activin Receptor Type IA (mutated R206 H) protein (ab167922)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGL PFLVQRTVAHQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWF RETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQ LTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKK NGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCF DSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRK VVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLT KIDNSLDKLKTDC
    • Molecular weight
      67 kDa including tags
    • Amino acids
      147 to 509
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167922 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    The specific activity of ab167922 was determined to be 6 nmol/min/mg.
  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Purity
    > 95 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Activin A receptor type I
    • Activin A receptor type II like kinase 2
    • Activin receptor type I
    • Activin receptor type-1
    • Activin receptor-like kinase 2
    • ACTR-I
    • ACTRI
    • Acvr1
    • ACVR1_HUMAN
    • ACVR1A
    • ACVRLK2
    • ALK 2
    • ALK-2
    • ALK2
    • FOP
    • Hydroxyalkyl protein kinase
    • Serine/threonine-protein kinase receptor R1
    • SKR1
    • TGF-B superfamily receptor type I
    • TGFB superfamily receptor type I
    • TSR-I
    • TSRI
    see all
  • Function
    On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin. May be involved for left-right pattern formation during embryogenesis.
  • Tissue specificity
    Expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells.
  • Involvement in disease
    Defects in ACVR1 are a cause of fibrodysplasia ossificans progressiva (FOP) [MIM:135100]. FOP is a rare autosomal dominant disorder of skeletal malformations and progressive extraskeletal ossification. Heterotopic ossification in FOP begins in childhood and can be induced by trauma or may occur without warning. Bone formation is episodic and progressive, leading to extra-articular ankylosis of all major joints of the axial and appendicular skeleton, rendering movement impossible.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
    Contains 1 GS domain.
    Contains 1 protein kinase domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • Sample Kinase Assay showing the specific activity of ab167922 as 6 nmol/min/mg.
  • SDS-PAGE analysis of ab167922.

References

ab167922 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167922.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up