Overview

  • Product name

    Recombinant Human ACTL6A protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQENGRGEFSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVD FPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEAIS PLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKL TELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGY VLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPAN WKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVH YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMC DIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTT VERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP
    • Molecular weight

      49 kDa including tags
    • Amino acids

      2 to 429
    • Tags

      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab134842 was expressed in E. coli as inclusion bodies, refolded using a temperature shift inclusion body refolding technology and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains a proprietary formulation of NaCl, EDTA, KCl, arginine, DTT and glycerol.

General Info

  • Alternative names

    • 53 kDa BRG1 associated factor A
    • 53 kDa BRG1-associated factor A
    • ACL6A_HUMAN
    • Actin like 6A
    • Actin like protein 6A
    • Actin related protein
    • Actin related protein 4
    • Actin related protein Baf53a
    • Actin-like protein 6A
    • Actin-related protein Baf53a
    • ACTL 6
    • ACTL 6A
    • ACTL6
    • ACTL6A
    • Arp4
    • ARPN BETA
    • ArpNbeta
    • BAF 53A
    • BAF complex 53 kDa subunit
    • BAF53
    • BAF53A
    • BRG1 associated factor
    • BRG1-associated factor 53A
    • hArpN beta
    • INO80 complex subunit K
    • INO80K
    • MGC5382
    see all
  • Function

    Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Required for maximal ATPase activity of SMARCA4/BRG1/BAF190A and for association of the SMARCA4/BRG1/BAF190A containing remodeling complex BAF with chromatin/nuclear matrix. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and is required for the proliferation of neural progenitors. During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity). Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. Putative core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
  • Sequence similarities

    Belongs to the actin family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab134842 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up