Description

  • Product name

    Recombinant Human ACTR3B protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR VLRGVDDLDFFIGDEAIDKPTYATKWPIRHGIIEDWDLMERFMEQVVFKY LRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALA ASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDI TYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPR KWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVV DEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLS EELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDY EEYGPSICRHNPVFGVMS
    • Amino acids

      1 to 418
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Actin like protein 3B
    • Actin related protein 3B
    • Actin related protein ARP4
    • ARP11
    • ARP3 actin related protein 3 homolog B (yeast)
    • ARP3 beta
    • ARP3BETA
    • ARP4
    • DKFZp686O24114
    see all
  • Relevance

    ACTR3B plays a role in the organization of the actin cytoskeleton and may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization. Together with an activating nucleation-promoting factor (NPF) it mediates the formation of branched actin networks. ACTR3B may also decrease the metastatic potential of tumors.
  • Cellular localization

    Cytoplasm, cytoskeleton. Cell projection.

Images

  • ab163516 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163516 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163516.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up