Description

  • Product name

    Recombinant Human Acyl-CoA Thioesterase 9 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGA STNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPEL REKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVD KIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDAT FVMVARDSENKG
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      1 to 212

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132624 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Glutathione, 0.32% Tris HCl

General Info

  • Alternative names

    • ACOT9
    • ACOT9_HUMAN
    • Acyl CoA thioester hydrolase 9
    • Acyl CoA thioesterase 9
    • Acyl coenzyme A thioesterase 9
    • Acyl-CoA thioester hydrolase 9
    • Acyl-CoA thioesterase 9
    • Acyl-coenzyme A thioesterase 9
    • Acyl-coenzyme A thioesterase 9, mitochondrial
    • CGI 16
    • mitochondrial
    see all
  • Function

    Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Active on long chain acyl-CoAs.
  • Sequence similarities

    Belongs to the acyl coenzyme A hydrolase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132624 stained with Coomassie Blue.

References

ab132624 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132624.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up