Overview

  • Product name

    Recombinant Human ADA2 beta protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGY QLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASR TPQEVMEHY
    • Amino acids

      2 to 110
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ADA2 beta
    • ADA2 like protein beta
    • ADA2, yeast, homolog of, beta
    • ADA2B
    • MGC21874 protein
    • TAD 2B
    • TAD2 beta
    • TAD2B
    • TADA2B
    • Transcriptional adapter 2 beta
    • transcriptional adaptor 2
    • transcriptional adaptor 2 (ADA2 homolog, yeast)-beta
    • transcriptional adaptor 2B
    • yeast ADA2 homolog beta
    see all
  • Relevance

    ADA2 beta is a 48 kDA nuclear protein that functions as a transcriptional adaptor protein that affects transcription by altering histone acetyltransferase activity and linking activation factors to basal transcriptional machinery. It coactivates PAX5 dependent transcription together with either GCN5L2 or SMARCA4.
  • Cellular localization

    Nuclear

Images

  • ab164942 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164942 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up