Description

  • Product name

    Recombinant Human ADAL protein (denatured)
    See all ADAL proteins and peptides
  • Purity

    > 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSEFMIEAEEQQPCKTDFYSELPKVELHA HLNGSISSHTMKKLIAQKPDLKIHDQMTVIDKGKKRTLEECFQMFQTIHQ LTSSPEDILMVTKDVIKEFADDGVKYLELRSTPRRENATGMTKKTYVESI LEGIKQSKQENLDIDVRYLIAVDRRGGPLVAKETVKLAEEFFLSTEGTVL GLDLSGDPTVGQAKDFLEPLLEAKKAGLKLALHLSEIPNQKKETQILLDL LPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLGKAWSFRSSR
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      1 to 267
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_001012987
  • Description

    Recombinant Human ADAL protein

Specifications

Our Abpromise guarantee covers the use of ab180314 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names

    • 4930578F03Rik
    • ADAL
    • ADAL_HUMAN
    • Adenosine deaminase like
    • Adenosine deaminase-like protein
    • DKFZp313B2137
    • FLJ44620
    • MGC62428
    • MGC63264
    • RP23-232N20.3
    see all
  • Function

    Putative nucleoside deaminase. May catalyze the hydrolytic deamination of adenosine or some similar substrate and play a role in purine metabolism.
  • Sequence similarities

    Belongs to the adenosine and AMP deaminases family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180314 (3 µg).

References

ab180314 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180314.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up