Overview

  • Product name

    Recombinant Human ADAM33 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQP WRTVSLEEPVSKPDMGLVALEAEGQELLLELEKNQ
    • Molecular weight

      36 kDa including tags
    • Amino acids

      1 to 85

Specifications

Our Abpromise guarantee covers the use of ab132080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A disintegrin and metalloprotease 33
    • A disintegrin and metalloproteinase domain 33
    • ADA33_HUMAN
    • ADAM 33
    • ADAM metallopeptidase domain 33
    • ADAM33
    • C20orf153
    • Disintegrin and metalloproteinase domain-containing protein 33
    • Disintegrin and reprolysin metalloproteinase family protein
    • DJ964F7.1
    • DKFZp434K0521
    • FLJ35308
    • FLJ36751
    • Metalloprotease disintegrin
    • MGC149823
    • MGC71889
    • PRO1891
    • UNQ873
    see all
  • Tissue specificity

    Expressed in all tissues, except liver, with high expression in placenta, lung, spleen and veins.
  • Involvement in disease

    Genetic variations in ADAM33 are associated with susceptibility to asthma (ASTHMA) [MIM:600807]. The most common chronic disease affecting children and young adults. It is a complex genetic disorder with a heterogeneous phenotype, largely attributed to the interactions among many genes and between these genes and the environment. It is characterized by recurrent attacks of paroxysmal dyspnea, with weezing due to spasmodic contraction of the bronchi.
  • Sequence similarities

    Contains 1 disintegrin domain.
    Contains 1 EGF-like domain.
    Contains 1 peptidase M12B domain.
  • Domain

    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications

    The precursor is cleaved by a furin endopeptidase.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132080, stained with Coomassie Blue.

References

This product has been referenced in:

  • Maliniemi P  et al. Biological and clinical significance of tryptophan-catabolizing enzymes in cutaneous T-cell lymphomas. Oncoimmunology 6:e1273310 (2017). Read more (PubMed: 28405495) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132080.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up