Recombinant Human ADAM8 protein (BSA and azide free) (ab174041)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IAPSRPWALMEQYEVVLPWRLPGPRVRRALPSHLGLHPERVSYVLGATGH NFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPD SAASLSTCAGLRGFFQVGSDLHLIEPLDEGGEGGRHAVYQAEHLLQTAGT CGVSDDSLGSLLGPRTAAVFRPRPGDSLPSRETRYVELYVVVDNAEFQML GSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSPDPSV TLENLLTWQARQRTRRHLHDNVQLITGVDFTGTTVGFARVSAMCSHSSGA VNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAGRCIMAG SIGSSFPRMFSDCSQAYLESFLERPQSVCLANAPDLSHLVGGPVCGNLFV ERGEQCDCGPPEDCRNRCCNSTTCQLAEGAQCAHGTCCQECKVKPAGELC RPKKDMCDLEEFCDGRHPECPEDAFQENGTPCSGGYCYNGACPTLAQQCQ AFWGPGGQAAEESCFSYDILPGCKASRYRADMCGVLQCKGGQQPLGRAIC IVDVCHALTTEDGTAYEPVPEGTRCGPEKVCWKGRCQDLHVYRSSNCSAQ CHNHGVCNHKQECHCHAGWAPPHCAKLLTEVHAASGSLPVFVVVVLVLL
    • Molecular weight
      72 kDa including tags
    • Amino acids
      17 to 665
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab174041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes

    Lyophilized from 0.22 μm filtered solution. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C.

    Information available upon request.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 50 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. After reconstitution store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -80°C.

General Info

  • Alternative names
    • A Disintegrin And Metalloproteinase domain 8
    • ADAM 8
    • ADAM 8 precursor
    • ADAM metallopeptidase domain 8
    • Adam8
    • ADAM8 protein
    • ADAM8_HUMAN
    • CD 156
    • CD156
    • CD156a
    • CD156a antigen
    • Cell surface antigen MS2
    • Disintegrin and metalloproteinase domain-containing protein 8
    • Human leukocyte differentiation antigen
    • Macrophage cysteine rich glycoprotein
    • MGC134985
    • MS 2
    • MS2
    see all
  • Function
    Possible involvement in extravasation of leukocytes.
  • Tissue specificity
    Expressed on neutrophils and monocytes.
  • Sequence similarities
    Contains 1 disintegrin domain.
    Contains 1 EGF-like domain.
    Contains 1 peptidase M12B domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of Human ADAM8 in reducing conditions. Gel stained overnight with Coomassie Blue. Protein migrates as 46 kDa and 67 kDa due to different glycosylation.

References

ab174041 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174041.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up