Description

  • Product name

    Recombinant Human ADAMDEC1 protein
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      IAIKQTPELTLHEIVCPKKLHILHKREIKNNQTEKHGKEERYEPEVQYQM ILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNI LNEKNSVASISTCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQ DPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLVLDNAF YKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVV PSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSP SSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYL SSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEV GEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTEVDHHHHHH
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      31 to 470
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 31 to 470. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Reconstitute for long term storage.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 0.87% Sodium chloride, 0.01% Zinc chloride

General Info

  • Alternative names

    • A disintegrin and metalloproteinase domain like protein decysin 1
    • A disintegrin and metalloproteinase domain-like protein decysin-1
    • ADAM DEC1
    • ADAM like decysin 1
    • ADAM like protein decysin 1
    • ADAM-like protein decysin-1
    • ADAMDEC 1
    • Adamdec1
    • ADEC1_HUMAN
    • Decysin
    • Disintegrin protease
    • M12.219
    see all
  • Function

    May play an important role in the control of the immune response and during pregnancy.
  • Tissue specificity

    Expressed highly in the small intestine and appendix, moderately in lymph node, mucosal lining of the colon, thymus, spleen and very weakly in the bone marrow. Predominantly expressed in dendritic cells (DC) of the germinal center. Weakly expressed in monocyte and highly expressed in macrophage. Absent in immature DC.
  • Sequence similarities

    Contains 1 disintegrin domain.
    Contains 1 peptidase M12B domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab191930 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up