Overview

  • Product name

    Recombinant human ADAMTS1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      FVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSV SLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDT AILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHE LGHVFNMPHDDAKQCASLNGVNQDSHMMASMLSNLDHSQPWSPCSAYMIT SFLDNGHGECLMDKPHNPIQLPGDLPGTSYDANRQCQFTFGEDSKHCPDA ASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCVNKTDRK HFDTPFHGNWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKR VRYRSCNLEDCPDN(H)6
    • Molecular weight

      41 kDa including tags
    • Amino acids

      253 to 616
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Activity of ab134430 is determined with recombinant aggrecan interglobular domain. ab134430 hydrolyzes the aggrecanase site within this domain (peptide bond E373 - A374 in Human aggrecan). The recombinant substrate is incubated at a concentration of 0.1 µM with 0.2-3.0 nM ADAMTS1 in 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM CaCl2, 1 µM leupeptin, 1 µM pepstatin, 1 mM Pefabloc, 0.05 % Brij 35 for 15 min at 37°C. Cleavage at the aggrecanase-site is estimated from the appearance of the hydrolysis fragment with the novel N-terminus ARGSVIL. The fragment is quantified with two monoclonal antibodies, one directed against the neoepitope ARGSVIL, the other against the sequence C-terminal to the neoepitope. Under the specified conditions the hydrolysis rate is > 0.06 nM hydrolysed substrate/min x nM truncated ADAMTS1. When related to mg enzyme, the value is > 1.4 nmoles hydrolyzed substrate/min x mg ADAMTS1.
  • Applications

    Functional Studies

    SDS-PAGE

    Inhibition Assay

  • Purity

    > 90 % SDS-PAGE.
    ab134430 was purified from insect cell culture supernatants.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.05% Brij, 0.05% Calcium chloride, 0.79% Tris HCl, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • A disintegrin and metalloproteinase with thrombospondin motifs 1
    • ADAM-TS 1
    • ADAM-TS1
    • ADAMTS
    • ADAMTS 1
    • ADAMTS-1
    • Adamts1
    • ATS1_HUMAN
    • C3 C5
    • KIAA1346,
    • METH 1
    • METH-1
    see all
  • Function

    Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover (By similarity). Has angiogenic inhibitor activity. Active metalloprotease, which may be associated with various inflammatory processes as well as development of cancer cachexia. May play a critical role in follicular rupture.
  • Sequence similarities

    Contains 1 disintegrin domain.
    Contains 1 peptidase M12B domain.
    Contains 3 TSP type-1 domains.
  • Domain

    The spacer domain and the TSP type-1 domains are important for a tight interaction with the extracellular matrix.
    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications

    The precursor is cleaved by a furin endopeptidase.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab134430 (2 µg)

References

ab134430 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up