Description

  • Product name

    Recombinant Human ADAMTS15 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AVDCRGSAGQRTVPACDAAHRPVETQACGEPCPTWELSAWSPCSKSCGRG FQRRSLKCVGHGGRLLARDQCNLHRKPQELDFCVLRPC
    • Amino acids

      863 to 950
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165819 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A disintegrin and metalloproteinase with thrombospondin motifs 15
    • A disintegrin like and metalloprotease reprolysin type with thrombospondin type 1 motif 15
    • A disintegrin like and metalloprotease reprolysin type with thrombospondin type 1 motif 15 preproprotein
    • A disintegrin like and metalloprotease with thrombospondin type 1 motif 15
    • A disintegrin like and metalloprotease with thrombospondin type 1 motif 15 preproprotein
    • ADAM metallopeptidase with thrombospondin type 1 motif 15
    • ADAM TS 15
    • ADAM TS15
    • ADAM-TS 15
    • ADAM-TS15
    • ADAMTS 15
    • ADAMTS-15
    • ADAMTS15
    • ATS15_HUMAN
    • MGC126403
    see all
  • Tissue specificity

    Expressed in fetal liver and kidney, but not in any of the adult tissues examined.
  • Sequence similarities

    Contains 1 disintegrin domain.
    Contains 1 peptidase M12B domain.
    Contains 3 TSP type-1 domains.
  • Domain

    The spacer domain and the TSP type-1 domains are important for a tight interaction with the extracellular matrix.
    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications

    The precursor is cleaved by a furin endopeptidase.
    Glycosylated. Can be O-fucosylated by POFUT2 on a serine or a threonine residue found within the consensus sequence C1-X(2)-(S/T)-C2-G of the TSP type-1 repeat domains where C1 and C2 are the first and second cysteine residue of the repeat, respectively. Fucosylated repeats can then be further glycosylated by the addition of a beta-1,3-glucose residue by the glucosyltransferase, B3GALTL. Fucosylation mediates the efficient secretion of ADAMTS family members. Also can be C-glycosylated with one or two mannose molecules on tryptophan residues within the consensus sequence W-X-X-W of the TPRs, and N-glycosylated. These other glycosylations can also facilitate secretion.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab165819 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165819 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165819.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up