Recombinant Human ADAMTS2 protein (ab160522)

Overview

  • Product name
    Recombinant Human ADAMTS2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAV DEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGK
    • Amino acids
      1112 to 1210
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160522 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A disintegrin and metalloproteinase with thrombospondin motifs 2
    • A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif 2
    • ADAM metallopeptidase with thrombospondin type 1 motif 2
    • ADAM TS 2
    • ADAM TS2
    • ADAM-TS 2
    • ADAM-TS2
    • ADAMTS 3
    • ADAMTS-2
    • ADAMTS2
    • ATS2_HUMAN
    • EC 3.4.24.14
    • EDS VIIB
    • EDS VIIC
    • hPCPNI
    • NPI
    • PC I NP
    • PC I-NP
    • PCINP
    • PCPNI
    • pNPI
    • Procollagen I N proteinase
    • Procollagen I N-proteinase
    • Procollagen I/II amino propeptide processing enzyme
    • Procollagen I/II amino propeptide-processing enzyme
    • Procollagen N endopeptidase
    • Procollagen N-endopeptidase
    see all
  • Function
    Cleaves the propeptides of type I and II collagen prior to fibril assembly. Does not act on type III collagen. May also play a role in development that is independent of its role in collagen biosynthesis.
  • Tissue specificity
    Expressed at high level in skin, bone, tendon and aorta and at low levels in thymus and brain.
  • Involvement in disease
    Defects in ADAMTS2 are the cause of Ehlers-Danlos syndrome type 7C (EDS7C) [MIM:225410]. EDS is a connective tissue disorder characterized by hyperextensible skin, atrophic cutaneous scars due to tissue fragility and joint hyperlaxity. EDS7C is marked by extremely fragile tissues, hyperextensible skin and easy bruising. Facial skin contains numerous folds, as in the cutis laxa syndrome.
  • Sequence similarities
    Contains 1 disintegrin domain.
    Contains 1 peptidase M12B domain.
    Contains 1 PLAC domain.
    Contains 4 TSP type-1 domains.
  • Domain
    The spacer domain and the TSP type-1 domains are important for a tight interaction with the extracellular matrix.
  • Post-translational
    modifications
    The precursor is cleaved by a furin endopeptidase.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab160522 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160522 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160522.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up