Overview

  • Product name

    Recombinant Human ADAMTS2/NPI protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      KHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAV DEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGK
    • Amino acids

      1112 to 1210
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160522 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as ADAMTS2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A disintegrin and metalloproteinase with thrombospondin motifs 2
    • A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif 2
    • ADAM metallopeptidase with thrombospondin type 1 motif 2
    • ADAM TS 2
    • ADAM TS2
    • ADAM-TS 2
    • ADAM-TS2
    • ADAMTS 3
    • ADAMTS-2
    • ADAMTS2
    • ATS2_HUMAN
    • EC 3.4.24.14
    • EDS VIIB
    • EDS VIIC
    • hPCPNI
    • NPI
    • PC I NP
    • PC I-NP
    • PCINP
    • PCPNI
    • pNPI
    • Procollagen I N proteinase
    • Procollagen I N-proteinase
    • Procollagen I/II amino propeptide processing enzyme
    • Procollagen I/II amino propeptide-processing enzyme
    • Procollagen N endopeptidase
    • Procollagen N-endopeptidase
    see all
  • Function

    Cleaves the propeptides of type I and II collagen prior to fibril assembly. Does not act on type III collagen. May also play a role in development that is independent of its role in collagen biosynthesis.
  • Tissue specificity

    Expressed at high level in skin, bone, tendon and aorta and at low levels in thymus and brain.
  • Involvement in disease

    Defects in ADAMTS2 are the cause of Ehlers-Danlos syndrome type 7C (EDS7C) [MIM:225410]. EDS is a connective tissue disorder characterized by hyperextensible skin, atrophic cutaneous scars due to tissue fragility and joint hyperlaxity. EDS7C is marked by extremely fragile tissues, hyperextensible skin and easy bruising. Facial skin contains numerous folds, as in the cutis laxa syndrome.
  • Sequence similarities

    Contains 1 disintegrin domain.
    Contains 1 peptidase M12B domain.
    Contains 1 PLAC domain.
    Contains 4 TSP type-1 domains.
  • Domain

    The spacer domain and the TSP type-1 domains are important for a tight interaction with the extracellular matrix.
  • Post-translational
    modifications

    The precursor is cleaved by a furin endopeptidase.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab160522 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160522 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160522.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up