Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCG GGASYSLRRCLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVK HHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLDGTRCYTESLD MCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATK SDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLSSTGTFLVD NSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHR WRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPK LQECNLDPCPARWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEE WKCMYTPKMPIAQPCNIFDCPKWLAQEWSPVTVPSFFVH
    • Amino acids
      1 to 439
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADAM TS related protein 1
    • ADAMTS like 1
    • ADAMTS-like protein 1
    • ADAMTSL-1
    • ADAMTSL1
    • ADAMTSR 1
    • ADAMTSR1
    • ATL1_HUMAN
    • C9orf94
    • Chromosome 9 open reading frame 94
    • MGC40193
    • Punctin
    • Punctin 1
    • Punctin-1
    • Thrombospondin
    see all
  • Tissue specificity
    Expressed primarily in adult skeletal muscle.
  • Sequence similarities
    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 PLAC domain.
    Contains 9 TSP type-1 domains.
  • Post-translational
    modifications
    Glycosylated.
    Disulfide bonds are present.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab164925 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164925 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164925.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up