Overview

  • Product name

    Recombinant Human ADCK1 protein 
  • Protein length

    Full length protein
  • Description

    Recombinant Human ADCK1 protein

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ASGIYFYSNKYLDPNDFGAVRVGRAVATTAVISYDYLTSLKSVPYGSEEY LQLRSKSWPVFLQVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEE YTSTLKVLHSQAPQSSMQEIRQVIREDLGKEIHDLFQSFDDTPLGTASLA QVHKAVLHDGRTVAVKVQHPKVRAQSSKDILLMEVLVLAVKQLFPEFEFM WLVDEAKKNLPLELDFLNEGRNAEKVSQMLRHFDFLKVPR IHWDLSTE RVLLMEFVDGGQVNDRDYMERNKIDVNEISRHLGKMYSEMIFVNGFVHCD PHPGNVLVRKHPGTGKAEIVLLDHGLYQMLTEEFRLNYCHLWQSLIWTDM KRVKEYSQRLGAGDLYPLFACMLTARSWDSVNRGISQAPVTATEDLEIRN NAANYLPQISHLLNHVPRQMLLILKTNDLLRGIEAALGTRASASSFLNMS RCCIRALAEHKKKNTCSFFRRTQISFSEAFNLWQINLHELILRVKGLKLA DRVLALICWLFPAPL
    • Molecular weight

      84 kDa including tags
    • Amino acids

      18 to 530
    • Tags

      proprietary tag N-Terminus
    • Additional sequence information

      Full length mature protein, not including signal peptide.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab191459 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 75 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.29% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

General Info

  • Alternative names

    • 2610005A10Rik
    • aarF domain containing kinase 1
    • ADCK 1
    • ADCK1
    • ADCK1_HUMAN
    • BOS_11212
    • FLJ39600
    • MGC142877
    • Uncharacterized aarF domain containing protein kinase 1
    • Uncharacterized aarF domain-containing protein kinase 1
    see all
  • Function

    The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr).
  • Sequence similarities

    Belongs to the protein kinase superfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • The purity of ab191459 was determined to be >75% by densitometry, approximate MW 84 kDa.

References

ab191459 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191459.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up