Description

  • Product name

    Recombinant Human ADCK5 protein
  • Purity

    > 75 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAEAREKRRMRLVVDGMGRFGRSLKVGLQISLDYWWCTNVVLRGVEENSP GYLEVMSACHQRAADALVAGAISNGGLYVKLGQGLCSFNHLLPPEYTRTL RVLEDRALKRGFQEVDELFLEDFQALPHELFQEFDYQPIAAASLAQVHRA KLHDGTSVAVKVQYIDLRDRFDGDIHTLELLLRLVEVMHPSFGFSWVLQD LKGTLAQELDFENEGRNAERCARELAHFPYVVVPRVHWDKSSKRVLTADF CAGCKVNDVEAIRSQGLAVHDIAEKLIKAFAEQIFYTGFIHSDPHPGNVL VRKGPDGKAELVLLDHGLYQFLEEKDRAALCQLWRAIILRDDAAMRAHAA ALGVQDYLLFAEMLMQRPVRLGQLWGSHLLSREEAAYMVDMARERFEAVM AVLRELPRPMLLVLRNINTVRAINVALGAPVDRYFLMAKRAVRGWSRLAG ATYRGVYGTSLLRHAKVVWEMLKFEVALRLETLAMRLTALLARALVHLSL VPPAEELYQYLET
    • Predicted molecular weight

      83 kDa including tags
    • Amino acids

      68 to 580
    • Tags

      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab191463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 0.29% Sodium chloride, 0.307% Glutathione, 0.003% EDTA, 0.004% DTT, 0.001% PMSF, 25% Glycerol

General Info

  • Alternative names

    • ADCK 5
    • aarF domain containing protein kinase 5
    • ADCK5
    • ADCK5_HUMAN
    • Uncharacterized aarF domain containing protein kinase 5
    • Uncharacterized aarF domain-containing protein kinase 5
    see all
  • Function

    The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr).
  • Sequence similarities

    Belongs to the protein kinase superfamily. ADCK protein kinase family.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE of ADCK5 protein fragment (ab191463).

References

ab191463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up