Overview

  • Product name

    Recombinant Human ADCY10/SAC protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      TTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRLSETQGNILEKCWL NMNKESWYSTSELKEDQWLQTILSLPSWEKIVAGRVNIQDLQKNKFLMRA NTVDNHF
    • Amino acids

      1504 to 1610
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153413 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as ADCY10

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3',5'-cyclic AMP synthetase
    • Adenylate cyclase 10
    • Adenylate cyclase 10 (soluble)
    • Adenylate cyclase homolog
    • AH related protein
    • ATP pyrophosphate-lyase
    • Germ cell soluble adenylyl cyclase
    • HCA2
    • hsAC
    • hypercalciuria absorptive
    • SAC
    • SACI
    • Sacy
    • Soluble adenylyl cyclase
    • Testicular soluble adenylyl cyclase
    • testicular soluble adenylyl cyclase (SAC)
    see all
  • Relevance

    ADCY10 belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction.
  • Cellular localization

    Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Note: Distributed to subcellular compartments containing cAMP targets. Found as a plasma membrane associated protein, protein concentrated in the perinuclear region and protein colocalized with actin or tubulin.

Images

  • ab153413 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153413 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153413.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up