Overview

  • Product name
    Recombinant Human ADCY7 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAHISMGMK LAIIERLKEHGDRRCMPDNNFHSLYVKRHQN
    • Amino acids
      197 to 277
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • adenylate cyclase 7
    • adenylyl cyclase
    • ATP pyrophosphate-lyase
    • KIAA0037
  • Relevance
    The membrane-bound adenylyl cyclases (ACs) represent one of the major families of effector enzymes for G protein-coupled receptors (GPCRs). Using the high inter-species homology of mammalian AC isoforms, nine Adenylyl cyclase (AC) isoforms, encoded by separate genes, have been identified until today. Human adenylate cyclase genes comprise of 11 to 26 exons, which are distributed over 16 to 430kb. The expression profile of these 9 AC isoforms in a panel of 16 human tissues and in human embryonic kidney (HEK) cells have been demonstrated earlier. The cAMP synthesizing enzymes are found in two forms: cytosolic (soluble) and membrane-bound (particulate). Stimulation of adenylate cyclases produce cAMP form ATP in response to the activation of GPCRs by various hormones, neurotransmitters and other regulatory molecules. cAMP, in subsequent steps down the signal transduction pathway, can stimulate cAMP-dependent protein kinase A (cPKA), and several other target molecules. Activation of cPKA can phosphorylate a broad range of substrates that regulate various metabolic pathways, gene expression, and affect memory functions etc. The stimulation of adenylate cyclases starts with interactions with GPCRs mediated signals initiated by Gs and Gi heterotrimeric G-proteins. The interaction of GPCR agonist (eg. Interaction of isopreternol to beta2 receptors) catalyses the exchange of GDP to GTP that is bound to G proteins. The GTP binding reduces the affinity of GsĄ to other GTP binding proteins and Gs-GTP complex stimulate the adenylate cyclase. In last several years, new members of particulate and soluble adenylate cyclase family have been identified and significant progress is made in understanding of the molecular mechanisms that underlie the regulation of these families of enzymes.
  • Cellular localization
    Integral membrane protein.

Images

  • ab157852 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157852 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157852.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up