Recombinant Human Adenine Nucleotide Translocase 1/ANT 1 protein (ab152178)

Overview

  • Product name

    Recombinant Human Adenine Nucleotide Translocase 1/ANT 1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQ YKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFL GGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAA QREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKG MLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIM YTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
    • Molecular weight

      60 kDa including tags
    • Amino acids

      1 to 298

Specifications

Our Abpromise guarantee covers the use of ab152178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Previously labelled as Adenine Nucleotide Translocase 1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AAC1
    • Adenine Nucleotide Translocase 1
    • Adenine nucleotide translocator 1
    • Adenine nucleotide translocator 1 (skeletal muscle)
    • ADP
    • ADP ATP carrier protein 1
    • ADP ATP carrier protein heart/skeletal muscle isoform T1
    • ADP/ATP translocase 1
    • ADT1_HUMAN
    • ANT
    • ANT 1
    • ANT1
    • ATP carrier protein
    • ATP carrier protein 1
    • heart/skeletal muscle isoform T1
    • PEO2
    • PEO3
    • SLC25A4
    • Solute carrier family 25 member 4
    • T1
    see all
  • Function

    Catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane.
  • Involvement in disease

    Defects in SLC25A4 are a cause of progressive external ophthalmoplegia with mitochondrial DNA deletions autosomal dominant type 2 (PEOA2) [MIM:609283]. Progressive external ophthalmoplegia is characterized by progressive weakness of ocular muscles and levator muscle of the upper eyelid. In a minority of cases, it is associated with skeletal myopathy, which predominantly involves axial or proximal muscles and which causes abnormal fatigability and even permanent muscle weakness. Ragged-red fibers and atrophy are found on muscle biopsy. A large proportion of chronic ophthalmoplegias are associated with other symptoms, leading to a multisystemic pattern of this disease. Additional symptoms are variable, and may include cataracts, hearing loss, sensory axonal neuropathy, ataxia, depression, hypogonadism, and parkinsonism.
  • Sequence similarities

    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152178 stained with Coomassie Blue.

References

ab152178 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up