Overview

  • Product name

    Recombinant Human ADH6 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMSTTGQVIRCKAAILWKPGAPFSIEE VEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEGAGIVE SIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSKTQLMSD GTSRFTCKGKSIYHFGNTSTFCEYTVIKEISVAKIDAVAPLEKVCLISCG FSTGFGAAINTAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIGVDVN KEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGIDFCFEAIGNLDVL AAALASCNESYGVCVVVGVLPASVQLKISGQLFFSGRSLKGSVFGGWK SRQHIPKLVADY MAEKLNLDPLITHTLNLDKINEAVELMKTGKCIRCI LLL
    • Molecular weight

      42 kDa including tags
    • Amino acids

      1 to 375
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab126661 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab126661 is purified using conventional chromatography techniques
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 30% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • ADH 5
    • ADH 6
    • Adh6
    • ADH6_HUMAN
    • Alcohol dehydrogenase 6
    • Alcohol dehydrogenase 6 (class V)
    • Aldehyde reductase
    • Class V alcohol dehydrogenase 6
    • UDP GLUCURONOSYLTRANSFERASE 2B10 PRECURSOR, MICROSOMAL
    see all
  • Tissue specificity

    Stomach and liver.
  • Sequence similarities

    Belongs to the zinc-containing alcohol dehydrogenase family. Class-V subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg of ab126661.

References

ab126661 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab126661.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up